LL-37: Pioneering Antimicrobial Peptide for Research
Advance Your Immunology Studies with LL-37
LL-37
LL-37, a cathelicidin-derived antimicrobial peptide, has emerged as a crucial focus in immunology and microbiology research. This multifunctional peptide offers exciting possibilities for studying innate immune responses and novel antimicrobial strategies.
LL-37 Specifications:
- Sequence: [LL-37, 37 aa]
- Molecular Weight: 4493.33 g/mol
- Purity: >95%
- Available in 10mg vials
Research Applications:
- Antimicrobial mechanism studies
- Innate immunity investigations
- Wound healing research
- Anti-biofilm activity analysis
How to Buy LL-37 Online
Acquiring high-quality LL-37 for your research is straightforward:
- Visit our LL-37 product page
- Select the 10mg option
- Proceed through our secure checkout process.
Why Source LL-37 From Us?
- Rigorous quality control ensures consistent purity
- Comprehensive documentation, including certificates of analysis
- Competitive pricing for research budgets
- Prompt, discreet shipping to research facilities worldwide
Expand Your Research Horizons
Incorporate LL-37 into your studies to explore its diverse biological activities. Whether you’re investigating antimicrobial resistance, wound healing processes, or immune modulation, LL-37 offers a versatile tool for cutting-edge research. To buy LL-37 10mg or inquire about bulk orders, please contact our dedicated research support team. We’re committed to supporting your groundbreaking work in immunology and microbiology. Important: LL-37 is intended for research use only. Not for diagnostic, therapeutic, or human use. Elevate your antimicrobial peptide research – purchase LL-37 through our trusted platform today.






Jeff joe herman –
You can tell the difference in quality the moment you start. No fluff just clean and potent material.